PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00063212001
Common NameGSBRNA2T00063212001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 391aa    MW: 42457.1 Da    PI: 6.5072
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00063212001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-39126185261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprCds++tkfCyynny+++qPr+fCk C+ryWt+GG++rnvPvG+grrknk+ 
  GSBRNA2T00063212001 126 PDKILPCPRCDSMETKFCYYNNYNVNQPRHFCKRCQRYWTAGGTMRNVPVGAGRRKNKSL 185
                          7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31122183IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32128184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.612130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSDPAIKLFG KTIPLPELVG VDSSSSYTEH QHQNPVQLSD SCTRDDEEMG DSGLAGEDGG  60
DDAGFHGGGS ESEKEEKDNQ LRDESSNVTM ASSITEKTKT TKATKTDEES SQNNETCSRE  120
GKLKKPDKIL PCPRCDSMET KFCYYNNYNV NQPRHFCKRC QRYWTAGGTM RNVPVGAGRR  180
KNKSLASHYN RHVGITSAED TQKAAARTDP NLLTFGTDSV LCESMASGLN LAEKSMLNTQ  240
TGQQEPNESV AISPLPKVPC FAGPPPPPAW PYPWNGVSWT VLPFYPPPAY WSCPGVSPGT  300
WNSSFTWMPQ PISPSGGSGP NSPTLEEAAK SSIWETLGIK KDEKADAFRG FRSSHKVKSC  360
LSDGKLPGRR PELLANPAAL SRSANFHESS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00063212001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647756.10.0PREDICTED: cyclic dof factor 2-like
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A078HF390.0A0A078HF39_BRANA; BnaC06g12530D protein
STRINGBra028437.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137951825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-136cycling DOF factor 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]